HORDB

ID: hor005575
Uniprot ID: P04204
Protein name: Exendin-2-long
Gene name: NA
Organism: Heloderma suspectum (Gila monster)
Family: Glucagon family
Source: Animal
Expression: Expressed by the venom gland. Not expressed in the pancreas, liver, stomach, small intestine, lung, heart, kidney, spleen, ovary, and brain.
Disease: NA
Comments: NA
Taxonomy: Heloderma (genus), Helodermatidae (family), Neoanguimorpha, Anguimorpha (infraorder), Toxicofera, Episquamata, Unidentata, Bifurcata, Squamata (order), Lepidosauria (class), Sauria, Sauropsida, Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
GO MF: GO:0005179 hormone activity; GO:0090729 toxin activity
GO BP: GO:0007165 signal transduction; GO:0008217 regulation of blood pressure; GO:0035821 modulation of process of another organism
GO CC: GO:0005576 extracellular region

Sequence: HSDAIFTEEYSKLLAKLALQKYLASILGSRTSPPPPS
Length: 37(47-83)
Propeptide: MKSILWLCVFGLLIATLFPVSWQMAIKSRLSSEDSETDQRLFESKRHSDAIFTEEYSKLLAKLALQKYLASILGSRTSPPPPSR
Signal peptide: MKSILWLCVFGLLIATLFPVSWQ
Modification: NA
Glycosylation: NA
Mutagenesis: NA

Function: Induces hypotension that is mediated by relaxation of cardiac smooth muscle
Mechanism: NA
Cross BBB: NA
Target: NA
Target Unid: NA
IC50: NA
EC50: NA
ED50: NA
kd: NA
Half life: NA

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

hor005575_AF2.pdb

hor005575_ESM.pdb

Mass:	467293	Formula:	C184H294N46O55
Absent amino acids:	CMNVW	Common amino acids:	LS
pI:	9.1	Basic residues:	5
Polar residues:	11	Hydrophobic residues:	13
Hydrophobicity:	-19.46	Boman Index:	-3941
Half-Life:	3.5 hour	Half-Life Yeast:	10 min
Half-Life E.Coli:	>10 hour	Aliphatic Index	95.14
Instability Index:	7107.57	Extinction Coefficient cystines:	2980
Absorbance 280nm:	82.78